• Mr.Steven Li
    Tel: +86-536-7971999

  • Ms.Abby Xu
    Tel: 0086-536-7971999

  • Mobile:13583611556
  • Tel:+86-536-7971999
  • Fax:
  • URL:http://www.jiashengchem.cn/
  • Province/state:Shandong
  • City:Weifang
  • Street:Yinhai Road,Shouguang
  • MaxCard:
Home > Products >  CJC-1295

CJC-1295 CAS NO.863288-34-0

  • FOB Price: USD: 55.00-60.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,T/T
  • Available Specifications:

    99%一级(1-5)Gram99%一级(6-10)Gram

  • Product Details

Keywords

  • CJC-1295 Without DAC
  • CJC1295
  • CJC1295 with out DAC

Quick Details

  • ProName: CJC-1295
  • CasNo: 863288-34-0
  • Molecular Formula: C152H252N44O42
  • Appearance: White Powder
  • Application: CJC-1295 is a long acting Growth Hormo...
  • DeliveryTime: Within 3-7 days after receipt of your ...
  • PackAge: As customer requestBy
  • Port: Qingdao/Shanghai China
  • ProductionCapacity: 100 Kilogram/Day
  • Purity: 99%min
  • Storage: -20°C
  • Transportation: By Sea/Air/Courier
  • LimitNum: 1 Gram
  • Density: 1.45

Superiority

Triumph Chemical Title

Triumph Company Office picture

Triumph Company advantage

Triumph Testing title picture

Triumph Testing way

Service:

1. Any inquiries will be replied within 12 hours.
2. Dedication to quality, supply & service.
3. Strictly on selecting raw materials.
4. OEM/ODM Available.
5. Reasonable & competitive price, fast lead time.
6. Sample is available for your evaluation & formulation development.

 

Advantage:

1. Faster delivery: Sample order in stock and 3-7

days for bulk production.
2. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.
3. After-Sale Service: 
1)International Authorized Third-Party Test For The Products You Demand. 
2)60 Days Warranty of quality of goods.

Q1. How does your factory control quality
All the raw material purchasing and production quality control are strictly following the ISO9001: 2008 management system. Besides, the full-featured detection equipment and GMP quality management system to provide the strongest guarantee for high quality product. We can provide our customers the detailed test report for the quality evaluation before the sample.

Q2. What's your main markets  
North America, Europe, Asia, etc.

Q3. What is your delivery term and delivery period  
We accept FOB, CIF, etc. You can choose the one which is the most convenient or cost effective for you. The sample within 3 days, and bulk order within 5 days.

Q4. What is your package
Powder: PE bag, glass bottle or PTFE bottle for inner packing, and aluminium foil bag for outer packing.
Liquid: glass bottle or PTFE bottle for inner packing, and aluminium foil bag for outer packing.
Bulk order: Fiber drum or steel drum.

Q5. What is the payment term  
we receive T/T, or L/C.

Q6. Will you supply samples for test the quality  
We'd like to offer our customers the free samples for the quality evaluation for most products, but the shipping cost is borne by customers.

Details

 
Why choose Triumph Chemical
 
 
(R)-(-)-4-Phenyl-2-oxazolidinone 90319-52-1 introduction

 

Product Name
CJC 1295 No DAC
Other Names
MPA-Lys30,D-Ala2,Gln8,Ala15,Leu27-GRF (1-29) amide
Purity
>99%
CAS No.
863288-34-0
Appearance
White powder
M.W.
3367.89
M.F.
C165H269N47O46
Shelf Life
2 Years

[Product Name]:CJC1295
[Synonyms]:CJC-1295WithoutDAC86328-34-0;CJC1295withoutDAC;CJC1295;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl;CJC-1295(10mg);Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-TyChemicalbookrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide
[CAS]: 863288-34-0
[MF]: C152H252N44O42
[MW]: 3367.89688
[Purity]: 99%
[Appearance]: White Crystalline Powder

[Crizotinib COA]:

 

Appearance
White to off white powder
Consistent
Purity(HPLC)
≥95%
98.17%
Water
<6.0%
4.46%
Acetic Acid
3.0-8.0%
5.60%
Trifluoroacetic Acid
<0.25%
0.055%
Peptide
≥80%
84.60%
MS
Consistent
Consistent

Functions:

 

CJC-1295 is a long acting Growth Hormone Releasing Hormone, which causes the anterior pituitary to release more growth hormone. GHRH is released in pulses in the body, which alternate with corresponding pulses of somatostatin (growth-hormone inhibiting-hormone). Clinical Research was first conducted for CJC-1295 during the mid-2000s. The objective of the peptide was to treat visceral fat deposits in obese AIDS patients, as increased levels of exogenous hgH are presumed to increase lipolysis (fat loss). The clinical research was ultimately successful for most research subjects. 

 

Applications:


CJC-1295 has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability to increase growth hormone and IGF-I secretion and its benefits, but it has been able to do so in very large amounts. Recent research studies have shown that CJC - 1295 stimulates GH and IGF-1 Secretion, and will keep a steady increase of HGH and IGF-1 with no increase in prolactin, leading to intense fat loss, and increases protein synthesis.

 

 

 
 
(R)-(-)-4-Phenyl-2-oxazolidinone 90319-52-1 Display
(R)-(-)-4-Phenyl-2-oxazolidinone 90319-52-1 Picture
(R)-(-)-4-Phenyl-2-oxazolidinone 90319-52-1 Package
 
 
Triumph Factory Srene
 
Triumph chemical Factory Picture:worshop ,warehouse
 
Product Testing way
 
Triumph chemical Testing lab
 
Payment Method
Triumph Method payment way:TT,LC,Paypal,WU,Escrow Service
 
Triumph payment way
Triumph chemical Shipping way: By Air,by Sea,Fedex,TNT
 
 
 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog